PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01006592001
Common NameVIT_00s0386g00010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 204aa    MW: 22639.8 Da    PI: 9.8616
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01006592001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.4e-201663249
                       ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        i+ +  rqvtfskRr g++KKA+EL +LCd e avi fs+ gk + +
  GSVIVT01006592001 16 LISASDARQVTFSKRRSGLFKKASELATLCDSETAVIAFSPGGKAFSF 63
                       5888999************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.263767IPR002100Transcription factor, MADS-box
SMARTSM004325.0E-29766IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-26880IPR002100Transcription factor, MADS-box
CDDcd002652.08E-32881No hitNo description
PRINTSPR004048.9E-19929IPR002100Transcription factor, MADS-box
PfamPF003192.0E-221763IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-192944IPR002100Transcription factor, MADS-box
PRINTSPR004048.9E-194465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0025501developmental stagefruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MERKTNAGRK KIEMKLISAS DARQVTFSKR RSGLFKKASE LATLCDSETA VIAFSPGGKA  60
FSFGHPSVEA VINRYDGQSQ ALDAGDQSVQ TDNLRELIQR YNALLDQLEV EKKRGEAIKR  120
MGMEMKAKTW LLTPVENLNP TQLQILKVLM EDLKKRVYQQ REELSKKART PRPLLDLNTV  180
EPDDPSASNP TKNNSMEGGG GSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4794910.0AM479491.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X091232.6, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002263270.21e-148PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLD7UE571e-149D7UE57_VITVI; Putative uncharacterized protein
STRINGVIT_00s0386g00010.t011e-149(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-38AGAMOUS-like 61